Protein coding transcript 171618

• Transcript: Ll_transcript_123939
• CDS coordinates: 181-1071 (+)
• Peptide sequence: MDAIRKQLDVLMGANRNGDVREVNRKYYDRDVCRLYLVGLCPHELFQLTKMDMGSCPNVHSLQLRKEYEEAKSKGIDNYDRELEDVIDKLIGECDRKIGRALKRLEEDDAKAAIAISVTEVTQTPEVLELSREIKEKLKEADQYDLEGKMDLKIRAMEIVDELRTKRADKQSTLLLDAFNKDRASLPQPLPNPPSLAAIPLVAPDPQTQELINEKLKKAEDLGEQGMVDEAQKALEEAEALKKLPPRQEPLLDSSKYTAADVRITDQKLRVCDICGAFLSVYDRLLCQFYEDNFCS*
• ORF Type: complete

Annotations of Ll_transcript_123939

• Blastp: Putative RNA-binding protein Luc7-like 2 from Homo with 33.54% of identity
• Blastx: Putative RNA-binding protein Luc7-like 2 from Homo with 32.35% of identity
• Eggnog: S. cerevisiae(COG5200)
• Kegg: Link to kegg annotations (51631)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019434236.1)
• Pfam: LUC7 N_terminus (PF03194.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;