Protein coding transcript 17163

• Transcript: Ll_transcript_356130
• CDS coordinates: 938-1516 (+)
• Peptide sequence: MQELRDMVAKVKDSNEEMMKIRKEIVDFHGEMVLLENYSALNYTGLVKILKKYDKRTGALIRLPFIQKVSQQPFFTTDLLYKLVKECEIMLDHLFPVNDPLTYGETTPQVEGCDPSTSGTSKSDALLLIPKELAEIQYMESLYMKSTISALNVLQEIRSGSSTVSMFSLPPLQISGLGEAWKKIPIMEQSAK*
• ORF Type: complete

Annotations of Ll_transcript_356130

• Blastp: SPX domain-containing protein 2 from Arabidopsis with 68.69% of identity
• Blastx: SPX domain-containing protein 2 from Arabidopsis with 68.69% of identity
• Eggnog: Vacuolar transporter chaperone(COG5036)
• Kegg: Link to kegg annotations (AT2G26660)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019431296.1)
• Pfam: SPX domain (PF03105.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;