Transcript | Ll_transcript_123932 |
---|---|
CDS coordinates | 181-1071 (+) |
Peptide sequence | MDAIRKQLDVLMGANRNGDVREVNRKYYDRDVCRLYLVGLCPHELFQLTKMDMGSCPNVHSLQLRKEYEEAKSKGIDNYDRELEDVIDKLIGECDRKIGRALKRLEEDDAKAAIAISVTEVTQTPEVLELSREIKEKLKEADQYDLEGKMDLKIRAMEIVDELRTKRADKQSTLLLDAFNKDRASLPQPLPNPPSLAAIPLVAPDPQTQELINEKLKKAEDLGEQGMVDEAQKALEEAEALKKLPPRQEPLLDSSKYTAADVRITDQKLRVCDICGAFLSVYDRLLCQFYEDNFCS* |
ORF Type | complete |
Blastp | Putative RNA-binding protein Luc7-like 2 from Homo with 33.54% of identity |
---|---|
Blastx | Putative RNA-binding protein Luc7-like 2 from Homo with 32.35% of identity |
Eggnog | S. cerevisiae(COG5200) |
Kegg | Link to kegg annotations (51631) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019434236.1) |
Pfam | LUC7 N_terminus (PF03194.14) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer