Protein coding transcript 171638

• Transcript: Ll_transcript_122224
• CDS coordinates: 994-1392 (+)
• Peptide sequence: MRSPTGEVIFGGETMRFWDLRAPWLEPLRGPNGLDLSRLKKDIQPWQERRSAEYMTHAPLGSLNSVGGVATEINAVNYVSPRSWLATSHFVLGFFLFVGHLWHAGRARAAAAGFEKGIDRDFEPVLSMTPLN*
• ORF Type: complete

Annotations of Ll_transcript_122224

• Blastp: Photosystem II CP43 reaction center protein from Lotus with 100% of identity
• Blastx: Photosystem II CP43 reaction center protein from Daucus sect. Daucus with 99.62% of identity
• Eggnog: -
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0002922)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (YP_008963601.1)
• Pfam: Photosystem II protein (PF00421.18)
• Rfam: tRNA (RF00005)
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;