Protein coding transcript 171639

• Transcript: Ll_transcript_122226
• CDS coordinates: 155-694 (+)
• Peptide sequence: MEHETTTTPLLELNPPSKKASKLQTLGNIIVSVVGTGVLGLPYAFRVAGWVAGSLGIAIAGIATFYCMLLLVRCKEKLASEEPLLESKTYGDLGYRCFGTPGRYLTELLISVALCGGSVAYLVFIGQNLHSVFQSHELTITSYIFILAPVEIGLSWIRSLSALAPFSIFADVCNVLAMGI
• ORF Type: 3prime_partial

Annotations of Ll_transcript_122226

• Blastp: Amino acid transporter ANT1 from Arabidopsis with 66.85% of identity
• Blastx: Amino acid transporter ANT1 from Arabidopsis with 70.81% of identity
• Eggnog: amino acid transport(COG0814)
• Kegg: Link to kegg annotations (AT3G11900)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019444175.1)
• Pfam: Transmembrane amino acid transporter protein (PF01490.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;