Transcript | Ll_transcript_122227 |
---|---|
CDS coordinates | 994-1392 (+) |
Peptide sequence | MRSPTGEVIFGGETMRFWDLRAPWLEPLRGPNGLDLSRLKKDIQPWQERRSAEYMTHAPLGSLNSVGGVATEINAVNYVSPRSWLATSHFVLGFFLFVGHLWHAGRARAAAAGFEKGIDRDFEPVLSMTPLN* |
ORF Type | complete |
Blastp | Photosystem II CP43 reaction center protein from Lotus with 100% of identity |
---|---|
Blastx | Photosystem II CP43 reaction center protein from Daucus sect. Daucus with 99.62% of identity |
Eggnog | - |
Kegg | - |
CantataDB | Link to cantataDB annotations (CNT0002922) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (YP_008963601.1) |
Pfam | Photosystem II protein (PF00421.18) |
Rfam | tRNA (RF00005) |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer