Transcript | Ll_transcript_356138 |
---|---|
CDS coordinates | 2-571 (+) |
Peptide sequence | FDNSNGPPLYFSCPHSHDSFVIEKIELIFYFGSIIVTEKMKFGKSLSNQIEKTLPQWRDKFLSYKELKKKLKLVEPASKGSDEERSAKRVRVDGEKMLKEEIDFRKSLENEVYKFNTFFVEKEEECIIRFKELRDMVAKVKDSNEEMMKIRKEIVDFHGEMVLLENYSALNYTGSSNFHNIICRSLTKT* |
ORF Type | 5prime_partial |
Blastp | SPX domain-containing protein 1 from Arabidopsis with 70.8% of identity |
---|---|
Blastx | SPX domain-containing protein 2 from Arabidopsis with 65.81% of identity |
Eggnog | Vacuolar transporter chaperone(COG5036) |
Kegg | Link to kegg annotations (AT5G20150) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019431296.1) |
Pfam | SPX domain (PF03105.18) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer