Protein coding transcript 17166

• Transcript: Ll_transcript_356142
• CDS coordinates: 2-544 (+)
• Peptide sequence: ANILFLFSLYHFHIPSLSLYFFSSFHYIHTHILLIFYFLNNRNNKNMKFGKSLSNQIEKTLPQWRDKFLSYKELKKKLKLVESAAEKGDEERASKRARIDGEKMLKEEIDFRKALENELHKFNNFFVEKEEEYIIRLKVLVFFLRLFDCPDVFCFEYLEIFLFFYLGKGRPYVFYIHMGH*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_356142

• Blastp: SPX domain-containing protein 1 from Arabidopsis with 67.02% of identity
• Blastx: SPX domain-containing protein 1 from Arabidopsis with 75.56% of identity
• Eggnog: Vacuolar transporter chaperone(COG5036)
• Kegg: Link to kegg annotations (AT5G20150)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019431296.1)
• Pfam: SPX domain (PF03105.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;