Protein coding transcript 171669

• Transcript: Ll_transcript_123833
• CDS coordinates: 194-841 (+)
• Peptide sequence: MKCYSKKCSFSSYYYCRSVLNEYMCGVRKMACEILDLMAEGLNIQPKNVFSKLLMDKESDSIFRVNHYPACPKKNHNDDENMIGFGEHTDPQIISLLRSNNTSGLQISLRDGSWISVPPDHSSFFINVGDSLQVMTNGRFRSVRHRVVANGSKSRLSMIYFVGPPLSEKIAPLPSLMKGNESLYKEFTWFEYKNSIYGSRLADNRLGHFERIAAS*
• ORF Type: complete

Annotations of Ll_transcript_123833

• Blastp: Gibberellin 2-beta-dioxygenase 1 from Pisum with 82.91% of identity
• Blastx: Gibberellin 2-beta-dioxygenase 1 from Pisum with 83.25% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424643.1)
• Pfam: 2OG-Fe(II) oxygenase superfamily (PF03171.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;