Protein coding transcript 1717

• Transcript: Ll_transcript_297608
• CDS coordinates: 59-616 (+)
• Peptide sequence: MAKRFAGVKVNWGSILERFPTKDEEQLMKLAKIRKAHETFIRRVAVLPEKPPAIDWAAYKNKIPAAFVDTIKQKYEAIQIPYPKNNAEEVINAKEQEMATKVAKAKEDAKNEIKQLEAKLAQLELLMPSEMMTIQEAIQTDPKCGVNVAFPTPTPHDDQETNRQWRIYIERKDKGLPADGLRPVG*
• ORF Type: complete

Annotations of Ll_transcript_297608

• Blastp: ATP synthase subunit d, mitochondrial from Sophophora with 28.57% of identity
• Blastx: ATP synthase subunit d, mitochondrial from Sophophora with 28.57% of identity
• Eggnog: energy coupled proton transport, down electrochemical gradient(ENOG4111IHJ)
• Kegg: Link to kegg annotations (Dmel_CG6030)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003591975.1)
• Pfam: ATP synthase D chain, mitochondrial (ATP5H) (PF05873.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;