Transcript | Ll_transcript_357003 |
---|---|
CDS coordinates | 344-814 (+) |
Peptide sequence | MTMLIAGHETSAAVLTWTFYLLSKEPRVMSKLQEEVDSIIGDRLPTIEDMKKLKYATRVINESLRLYPQPPVLIRRSLENDLLGEYPIKRGEDIFISVWNLHHSPKQWDDADKFEPERWALDGPNPNETNQNFRYLPFGGGQRKCVGDLFATYEVM* |
ORF Type | complete |
Blastp | Protein LUTEIN DEFICIENT 5, chloroplastic from Arabidopsis with 83.77% of identity |
---|---|
Blastx | Protein LUTEIN DEFICIENT 5, chloroplastic from Arabidopsis with 84.15% of identity |
Eggnog | Cytochrome p450(COG2124) |
Kegg | Link to kegg annotations (AT1G31800) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019429423.1) |
Pfam | Cytochrome P450 (PF00067.21) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer