Protein coding transcript 17189

• Transcript: Ll_transcript_356994
• CDS coordinates: 478-855 (+)
• Peptide sequence: MSKLQEEVDSIIGDRLPTIEDMKKLKYATRVINESLRLYPQPPVLIRRSLENDLLGEYPIKRGEDIFISVWNLHHSPKQWDDADKFEPERWALDGPNPNETNQNFRYLPFGGGQRKCVGDLFATYE
• ORF Type: 3prime_partial

Annotations of Ll_transcript_356994

• Blastp: Protein LUTEIN DEFICIENT 5, chloroplastic from Arabidopsis with 82.54% of identity
• Blastx: Protein LUTEIN DEFICIENT 5, chloroplastic from Arabidopsis with 78.83% of identity
• Eggnog: Cytochrome p450(COG2124)
• Kegg: Link to kegg annotations (AT1G31800)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019429423.1)
• Pfam: Cytochrome P450 (PF00067.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;