Protein coding transcript 171900

• Transcript: Ll_transcript_24821
• CDS coordinates: 37-531 (+)
• Peptide sequence: MQVVSSTSCFLKLGVKASWDTQQRPSYNPNAPRKELNKKLTKTQSIPSPPPLISTKKEQYISDLLKRNTAPNSSTINGKEKQKQEEEEEDDDGGDNGVYLGYERWLPTPPKVVKPRSVFNAATLAYIGDCIYELYARRHFLFPPLGIEEYNVRVTAVVRCEAQV*
• ORF Type: complete

Annotations of Ll_transcript_24821

• Blastp: Mini-ribonuclease 3 from Thermosynechococcus with 41.54% of identity
• Blastx: Mini-ribonuclease 3 from Synechocystis with 43.1% of identity
• Eggnog: Involved in correct processing of both the 5' and 3' ends of 23S rRNA precursor. Processes 30S rRNA precursor transcript even in absence of ribonuclease 3 (Rnc)(COG1939)
• Kegg: Link to kegg annotations (tlr0428)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447387.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;