Transcript | Ll_transcript_24823 |
---|---|
CDS coordinates | 37-531 (+) |
Peptide sequence | MQVVSSTSCFLKLGVKASWDTQQRPSYNPNAPRKELNKKLTKTQSIPSPPPLISTKKEQYISDLLKRNTAPNSSTINGKEKQKQEEEEEDDDGGDNGVYLGYERWLPTPPKVVKPRSVFNAATLAYIGDCIYELYARRHFLFPPLGIEEYNVRVTAVVRCEAQV* |
ORF Type | complete |
Blastp | Mini-ribonuclease 3 from Thermosynechococcus with 41.54% of identity |
---|---|
Blastx | - |
Eggnog | Involved in correct processing of both the 5' and 3' ends of 23S rRNA precursor. Processes 30S rRNA precursor transcript even in absence of ribonuclease 3 (Rnc)(COG1939) |
Kegg | Link to kegg annotations (tlr0428) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019447387.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer