Transcript | Ll_transcript_24851 |
---|---|
CDS coordinates | 352-1221 (+) |
Peptide sequence | MEEQYLIMKPNEITTRAFKIYPNTDQASKYFCAAILKDSDYGEVDRAECQFTTTGMVLDNGTQGMPFQLPETSISGFFDSVERLWNTIWTSIIEFITGKTCRQKCSGFFDFKCHIQYVCLSWVMMFGLFLAIFPTVLVLLWLLHQKGVFDPLYDWWEDIFGADEQTFMDKQNLEIVKGHHHTHSNKHRKQEHRHPKHGAHYRRRIGYEHKHRHSERDSNHFDYLHHVHKETHKHSHKKNIDVVQHHGDKHRREGDTSKGLKLMEQKHHKERPEKYDKHNEVLLYEPEDE* |
ORF Type | complete |
Blastp | Protein HAPLESS 2 from Arabidopsis with 66.46% of identity |
---|---|
Blastx | Protein HAPLESS 2 from Arabidopsis with 65.71% of identity |
Eggnog | single fertilization(ENOG4111J3I) |
Kegg | Link to kegg annotations (AT4G11720) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019422547.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer