Protein coding transcript 171912

• Transcript: Ll_transcript_24872
• CDS coordinates: 232-789 (+)
• Peptide sequence: MPSRRRTLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQFEDRLFTLQIWDTAGQERFQSLGVAFYRGADCCVLVYDVNSLKSFENLNNWREEFLIQASPSDPENFPFVVIGNKIDVDGGNSRVVSEKKARAWCASKGNIPYFETSAKEGVNVEEAFQCIAKNALKSGEEEEL*
• ORF Type: complete

Annotations of Ll_transcript_24872

• Blastp: Ras-related protein Rab7 from Pisum with 95.68% of identity
• Blastx: Ras-related protein Rab7 from Pisum with 95.56% of identity
• Eggnog: -
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0000393)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019412820.1)
• Pfam: ADP-ribosylation factor family (PF00025.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;