Protein coding transcript 171913

• Transcript: Ll_transcript_24863
• CDS coordinates: 1-558 (+)
• Peptide sequence: LGDSGAGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQFEDRLFTLQIWDTAGQERFQSLGVAFYRGADCCVLVYDVNSLKSFENLNNWREEFLIQASPSDPENFPFVVIGNKIDVDGGNSRVVSEKKARAWCASKGNIPYFETSAKEGVNVEEAFQCIAKNALKSGEEEELYLPDTIDVGSSSQQ
• ORF Type: internal

Annotations of Ll_transcript_24863

• Blastp: Ras-related protein RABG3f from Arabidopsis with 94.09% of identity
• Blastx: Ras-related protein RABG3f from Arabidopsis with 94.09% of identity
• Eggnog: member RAS oncogene family(ENOG410XNZV)
• Kegg: Link to kegg annotations (AT3G18820)
• CantataDB: Link to cantataDB annotations (CNT0000393)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019412820.1)
• Pfam: Ras family (PF00071.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;