Transcript | Ll_transcript_23685 |
---|---|
CDS coordinates | 76-600 (+) |
Peptide sequence | MEFVPEEGKHLHEDCSTLILPALSIGNVGQLVADLLVSSMDAERVGYLDDPYVLPCVGNDAYGPIPQGDLALPLEAYDSISNALTIIQQRSPVVKGRMVEFAKNLADFVAASGKKHIILLSSLDFGKWQKVDMSRFTTSPVPTTMEQMKTVNSLGGRNLRIMTLLKSIGNILAI* |
ORF Type | complete |
Blastp | Proteasome assembly chaperone 2 from Nematostella with 45.05% of identity |
---|---|
Blastx | Cold-regulated 413 plasma membrane protein 2 from Arabidopsis with 68.31% of identity |
Eggnog | Proteasome (Prosome, macropain) assembly chaperone 2(ENOG410XRHJ) |
Kegg | Link to kegg annotations (NEMVE_v1g117792) |
CantataDB | Link to cantataDB annotations (CNT0000256) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_013456328.1) |
Pfam | PAC2 family (PF09754.8) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer