Protein coding transcript 171979

• Transcript: Ll_transcript_23685
• CDS coordinates: 76-600 (+)
• Peptide sequence: MEFVPEEGKHLHEDCSTLILPALSIGNVGQLVADLLVSSMDAERVGYLDDPYVLPCVGNDAYGPIPQGDLALPLEAYDSISNALTIIQQRSPVVKGRMVEFAKNLADFVAASGKKHIILLSSLDFGKWQKVDMSRFTTSPVPTTMEQMKTVNSLGGRNLRIMTLLKSIGNILAI*
• ORF Type: complete

Annotations of Ll_transcript_23685

• Blastp: Proteasome assembly chaperone 2 from Nematostella with 45.05% of identity
• Blastx: Cold-regulated 413 plasma membrane protein 2 from Arabidopsis with 68.31% of identity
• Eggnog: Proteasome (Prosome, macropain) assembly chaperone 2(ENOG410XRHJ)
• Kegg: Link to kegg annotations (NEMVE_v1g117792)
• CantataDB: Link to cantataDB annotations (CNT0000256)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_013456328.1)
• Pfam: PAC2 family (PF09754.8)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;