Protein coding transcript 171980

• Transcript: Ll_transcript_23686
• CDS coordinates: 76-423 (+)
• Peptide sequence: MEFVPEEGKHLHEDCSTLILPALSIGNVGQLVADLLVSSMDAERVGYLDDPYVLPCVGNDAYGPIPQGDLALPLEAYDSISNALTIIQQRSPVVKVLIEYTFSIFLCFISCNNIRK
• ORF Type: 3prime_partial

Annotations of Ll_transcript_23686

• Blastp: Proteasome assembly chaperone 2 from Nematostella with 51.81% of identity
• Blastx: Proteasome assembly chaperone 2 from Nematostella with 51.81% of identity
• Eggnog: Proteasome (Prosome, macropain) assembly chaperone 2(ENOG410XRHJ)
• Kegg: Link to kegg annotations (NEMVE_v1g117792)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019412869.1)
• Pfam: PAC2 family (PF09754.8)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;