Protein coding transcript 171981

• Transcript: Ll_transcript_23677
• CDS coordinates: 301-654 (+)
• Peptide sequence: MWKSLDFQEEAVQLMNSDLKELSVAANKLAHHAIQLGGKGFGVSFFGLIAAIAAMYVLLLLYYILKHNNIYLSLSLSCLYTLQVYGFAVFFHFATLFKHTSFYFLSYSCFMGFIILL*
• ORF Type: complete

Annotations of Ll_transcript_23677

• Blastp: Cold-regulated 413 plasma membrane protein 2 from Arabidopsis with 52.94% of identity
• Blastx: Cold-regulated 413 plasma membrane protein 2 from Arabidopsis with 62.96% of identity
• Eggnog: Cold acclimation protein(ENOG4111SCF)
• Kegg: Link to kegg annotations (AT3G50830)
• CantataDB: Link to cantataDB annotations (CNT0000256)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019448532.1)
• Pfam: Cold acclimation protein WCOR413 (PF05562.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;