Transcript | Ll_transcript_23677 |
---|---|
CDS coordinates | 301-654 (+) |
Peptide sequence | MWKSLDFQEEAVQLMNSDLKELSVAANKLAHHAIQLGGKGFGVSFFGLIAAIAAMYVLLLLYYILKHNNIYLSLSLSCLYTLQVYGFAVFFHFATLFKHTSFYFLSYSCFMGFIILL* |
ORF Type | complete |
Blastp | Cold-regulated 413 plasma membrane protein 2 from Arabidopsis with 52.94% of identity |
---|---|
Blastx | Cold-regulated 413 plasma membrane protein 2 from Arabidopsis with 62.96% of identity |
Eggnog | Cold acclimation protein(ENOG4111SCF) |
Kegg | Link to kegg annotations (AT3G50830) |
CantataDB | Link to cantataDB annotations (CNT0000256) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019448532.1) |
Pfam | Cold acclimation protein WCOR413 (PF05562.10) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer