Protein coding transcript 172011

• Transcript: Ll_transcript_25046
• CDS coordinates: 517-1038 (+)
• Peptide sequence: MDKREPDDPSPYLLAIWAPGETANSTEPPERRCGSQDSTDMCNDKTCFSCNSVREAKSQTVRGTLLIPCRTATRGSFPLNGTYFQVNELFADHASSVQPIDIPRAWIWNLPRRTVYFGTSVSSIFKGLSTPEIQHCFWRGFVCVRGFDQQKRAPRPLQARLHFAASRSAKTKK*
• ORF Type: complete

Annotations of Ll_transcript_25046

• Blastp: Transcriptional activator DEMETER from Arabidopsis with 77.33% of identity
• Blastx: Transcriptional activator DEMETER from Arabidopsis with 79.43% of identity
• Eggnog: endonuclease III(COG0177)
• Kegg: Link to kegg annotations (AT5G04560)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427913.1)
• Pfam: Permuted single zf-CXXC unit (PF15629.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;