Transcript | Ll_transcript_25046 |
---|---|
CDS coordinates | 517-1038 (+) |
Peptide sequence | MDKREPDDPSPYLLAIWAPGETANSTEPPERRCGSQDSTDMCNDKTCFSCNSVREAKSQTVRGTLLIPCRTATRGSFPLNGTYFQVNELFADHASSVQPIDIPRAWIWNLPRRTVYFGTSVSSIFKGLSTPEIQHCFWRGFVCVRGFDQQKRAPRPLQARLHFAASRSAKTKK* |
ORF Type | complete |
Blastp | Transcriptional activator DEMETER from Arabidopsis with 77.33% of identity |
---|---|
Blastx | Transcriptional activator DEMETER from Arabidopsis with 79.43% of identity |
Eggnog | endonuclease III(COG0177) |
Kegg | Link to kegg annotations (AT5G04560) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019427913.1) |
Pfam | Permuted single zf-CXXC unit (PF15629.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer