Transcript | Ll_transcript_25496 |
---|---|
CDS coordinates | 1-576 (+) |
Peptide sequence | PFQHITLIIYGYRQLSGLYKTTLISLLLVSSSFPYTTHLKASMASLMLLHRKLRTTRSFHFHVRVRSFSEKIEKIVIANRGEIACRIMRTAKRLGIRTVAIYSDADKDSLHVHSADEAIRIGPPPPRLSYLNAPSILDAAIRSGAQAIHPGYGFLSESADFAQLCEDKGLTFIGPPASAIRDMGDKRYLYD* |
ORF Type | 5prime_partial |
Blastp | Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial from Soja with 77.48% of identity |
---|---|
Blastx | Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial from Soja with 77.48% of identity |
Eggnog | carboxylase(COG4770) |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019441883.1) |
Pfam | Biotin carboxylase, N-terminal domain (PF00289.21) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer