Protein coding transcript 172074

• Transcript: Ll_transcript_23960
• CDS coordinates: 2-331 (+)
• Peptide sequence: SRRVVIGYDEGTIMVKLGREEPVASMDNSGKIIWAKHNEIQTVNIRSVGADVEIADGERLPLAVKELGTCDLYPQSLRHNPNGRFVVVCGDGEYIIYTALAWRNRSFGSA
• ORF Type: internal

Annotations of Ll_transcript_23960

• Blastp: Coatomer subunit beta'-2 from Oryza sativa with 91.82% of identity
• Blastx: Coatomer subunit beta'-2 from Oryza sativa with 91.82% of identity
• Eggnog: coatomer protein complex, subunit beta 2 (beta prime)(ENOG410XNNY)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014634628.1)
• Pfam: Coatomer WD associated region (PF04053.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;