Transcript | Ll_transcript_23120 |
---|---|
CDS coordinates | 1253-1693 (+) |
Peptide sequence | MLYGGADQVLRKHFLSDKAESELDRLKSRFSQLYHDNLLKLERPKEGLKDWLEAVNTARIPCAVVSSLDRRNMVEALEVLGLSNYFQAIVTEEDGMESIAHRFLSAAVKLDRKPSKCVVFEDDPRGVTAAHNCTMMAVALIGAYPA* |
ORF Type | complete |
Blastp | 5-amino-6-(5-phospho-D-ribitylamino)uracil phosphatase, chloroplastic from Arabidopsis with 26.36% of identity |
---|---|
Blastx | 5-amino-6-(5-phospho-D-ribitylamino)uracil phosphatase, chloroplastic from Arabidopsis with 24.38% of identity |
Eggnog | HAD-superfamily hydrolase subfamily IA variant 3(COG0637) |
Kegg | Link to kegg annotations (AT4G11570) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019437593.1) |
Pfam | Haloacid dehalogenase-like hydrolase (PF13419.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer