Protein coding transcript 172100

• Transcript: Ll_transcript_23101
• CDS coordinates: 58-975 (+)
• Peptide sequence: MASSPSIPSSHPQQSYHHLQPFSSFSSNLPLLKFKRLGFVKNRLVARSSSGSKEFGSVNGFTPNKLFMQEAIGAEYGEGFETFRTDGPLKVDVDYLNDKLQEGFLKRIRYAMKPDEAYGLIFSWDNVVADTRVLKRKAWKQLASEEGKDIPEDGDIQRLMLYGGADQVLRKHFLSDKAESELDRLKSRFSQLYHDNLLKLERPKEGLKDWLEAVNTARIPCAVVSSLDRRNMVEALEVLGLSNYFQAIVTEEDGMESIAHRFLSAAVKLDRKPSKCVVFEDDPRGVTAAHNCTMMAVALIGAYPA*
• ORF Type: complete

Annotations of Ll_transcript_23101

• Blastp: 5-amino-6-(5-phospho-D-ribitylamino)uracil phosphatase, chloroplastic from Arabidopsis with 26.46% of identity
• Blastx: 5-amino-6-(5-phospho-D-ribitylamino)uracil phosphatase, chloroplastic from Arabidopsis with 26.46% of identity
• Eggnog: HAD-superfamily hydrolase subfamily IA variant 3(COG0637)
• Kegg: Link to kegg annotations (AT4G11570)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437593.1)
• Pfam: Haloacid dehalogenase-like hydrolase (PF13419.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;