Protein coding transcript 172137

• Transcript: Ll_transcript_25537
• CDS coordinates: 67-927 (+)
• Peptide sequence: MSILLVLAFCLLWPGLTKNVAGFACNWGRVSSQPLPGDIAVKLMKDNGFDKVKLFDPDPEALKALANSGIKVMVGIPNVYLEELVENNNFADDWVAQNVTAYVEDGVDIRYVAVSNEAFLMDFKDRFIHKVLPALKAVKASLDKAGLGKKVQVTIPINADIYETSNGLPSGGDFRANVTDEVVEILKFLNDNNAPLAINIYPYLSLYYDSHFPKEYAFFNATADSLVDGNITYTNAFDGNLDTLISALEKHDLGSLSIIVGEVGWPTNGAVDANIANAQRIDIHNG*
• ORF Type: complete

Annotations of Ll_transcript_25537

• Blastp: Glucan endo-1,3-beta-glucosidase 6 from Arabidopsis with 47.19% of identity
• Blastx: Glucan endo-1,3-beta-glucosidase 6 from Arabidopsis with 47.37% of identity
• Eggnog: glucan endo-1,3-beta-glucosidase(ENOG410YE7X)
• Kegg: Link to kegg annotations (AT5G58090)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417378.1)
• Pfam: Glycosyl hydrolases family 17 (PF00332.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;