| Transcript | Ll_transcript_25542 |
|---|---|
| CDS coordinates | 239-568 (+) |
| Peptide sequence | MESDLSWEQNTLINELIQGMEVAKKLKEDLKTPYLVGTRDMLVQRILSSYEKALLILNASAPKSQTMSPATATSLPDSLISFDGSPMREDNDDGVIKGEKEVKTDSKKR* |
| ORF Type | complete |
| Blastp | Probable WRKY transcription factor 53 from Arabidopsis with 37.98% of identity |
|---|---|
| Blastx | Probable WRKY transcription factor 41 from Arabidopsis with 40.31% of identity |
| Eggnog | Transcription factor(ENOG410YZU1) |
| Kegg | Link to kegg annotations (AT4G23810) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019420831.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer