Transcript | Ll_transcript_25548 |
---|---|
CDS coordinates | 579-1331 (+) |
Peptide sequence | MYVVILTFVAICFLKFDFRKTMTKWMDQIRVSSESGLEGSHEDGYNWRKYGQKDILGAKYPRSYYRCTFRNTQGCWATKQVQRSDEDPTIFDITYRGKHTCSQGSNAALAPKSPDEKEKPSSYNSYIHHAKQPQETVTMLRNNLTVMTDNLGNEEISHPFTFPSTSFGCMTQENDSFLPLAVDNDPFMNSLFQTHLLSSTIPQSNYFPSPSFQMNEFDWVYNMPHSESDITEIISTNTSATNSPIPELKF* |
ORF Type | complete |
Blastp | Probable WRKY transcription factor 41 from Arabidopsis with 44.07% of identity |
---|---|
Blastx | Probable WRKY transcription factor 53 from Arabidopsis with 50.96% of identity |
Eggnog | Transcription factor(ENOG410YZU1) |
Kegg | Link to kegg annotations (AT4G11070) |
CantataDB | Link to cantataDB annotations (CNT0001318) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019446527.1) |
Pfam | WRKY DNA -binding domain (PF03106.14) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer