Protein coding transcript 172143

• Transcript: Ll_transcript_25548
• CDS coordinates: 579-1331 (+)
• Peptide sequence: MYVVILTFVAICFLKFDFRKTMTKWMDQIRVSSESGLEGSHEDGYNWRKYGQKDILGAKYPRSYYRCTFRNTQGCWATKQVQRSDEDPTIFDITYRGKHTCSQGSNAALAPKSPDEKEKPSSYNSYIHHAKQPQETVTMLRNNLTVMTDNLGNEEISHPFTFPSTSFGCMTQENDSFLPLAVDNDPFMNSLFQTHLLSSTIPQSNYFPSPSFQMNEFDWVYNMPHSESDITEIISTNTSATNSPIPELKF*
• ORF Type: complete

Annotations of Ll_transcript_25548

• Blastp: Probable WRKY transcription factor 41 from Arabidopsis with 44.07% of identity
• Blastx: Probable WRKY transcription factor 53 from Arabidopsis with 50.96% of identity
• Eggnog: Transcription factor(ENOG410YZU1)
• Kegg: Link to kegg annotations (AT4G11070)
• CantataDB: Link to cantataDB annotations (CNT0001318)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446527.1)
• Pfam: WRKY DNA -binding domain (PF03106.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;