Protein coding transcript 172170

• Transcript: Ll_transcript_23566
• CDS coordinates: 386-1180 (+)
• Peptide sequence: MNPLFSMQPHPLKFIELSQLHNQHQNVVSTGLGLSFGDQQKQRLQLHQQQHGCNSSSSLSLLSEGFSSQMKQKRDEFDIFLHAQGEELMCTLAEKMQRHYQELLRKAEDAVARRLREKEAEMEKAMRRNAELEARAAQLSAEAQVWQARAMTQEAAAASLQAQLQHTMTAAGCRGGDDGGAGLSFAMDGGQAEDAESAYIDPDRVEVVATVAARAKCKGCGKRVASVVVLPCRHLCICAECDSRLRACPVCLTLKNSTVEVYLS*
• ORF Type: complete

Annotations of Ll_transcript_23566

• Blastp: Probable BOI-related E3 ubiquitin-protein ligase 2 from Arabidopsis with 33.49% of identity
• Blastx: E3 ubiquitin-protein ligase BOI from Arabidopsis with 32.2% of identity
• Eggnog: protein binding zinc ion binding(ENOG4111S1X)
• Kegg: Link to kegg annotations (AT1G79110)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446011.1)
• Pfam: Zinc finger, C3HC4 type (RING finger) (PF13920.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;