Protein coding transcript 172179

• Transcript: Ll_transcript_23561
• CDS coordinates: 902-1720 (+)
• Peptide sequence: MNPLFSMQSQNPQLIDLSQLHNQQQNVVSIGLGLSFDQQQQRLQLHQQPQQQQLHGCYSSSYLSLLSEGFSSQMKRQRDEIDQFLHAQGDELQRTLAEKRQKHCQALSRAAAEVVARLLREKEAEMEKATRQNAELEAHAARLSAEAQMWQAKVRAQEAAAVSLQAQLQQTMMALGAGGCHGGDGGGAGLSCAMDDGQAEDAESAYIDPDRVEVIAPVEAARAKCRGCGKRVASVVVLPCRHLCMCAECDTHFKACPVCHILKNSTIEVLIS*
• ORF Type: complete

Annotations of Ll_transcript_23561

• Blastp: E3 ubiquitin-protein ligase BOI from Arabidopsis with 30.73% of identity
• Blastx: BOI-related E3 ubiquitin-protein ligase 1 from Arabidopsis with 28.57% of identity
• Eggnog: protein binding zinc ion binding(ENOG4111S1X)
• Kegg: Link to kegg annotations (AT4G19700)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019420281.1)
• Pfam: Zinc finger, C3HC4 type (RING finger) (PF13920.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;