Transcript | Ll_transcript_24377 |
---|---|
CDS coordinates | 168-467 (+) |
Peptide sequence | MASITEEESTVKEPLDLIRLSLDERIYVKLRSDRELRGKLHAYDQHLNMILGDVEEVVTTVEIDDETYEEIVRTTKRTVPFLFVRGDGVILVSPPLRTA* |
ORF Type | complete |
Blastp | Sm-like protein LSM3B from Arabidopsis with 92.55% of identity |
---|---|
Blastx | Sm-like protein LSM3B from Arabidopsis with 92.55% of identity |
Eggnog | LSM3 homolog, U6 small nuclear RNA associated (S. cerevisiae)(ENOG4111PB8) |
Kegg | Link to kegg annotations (AT1G76860) |
CantataDB | Link to cantataDB annotations (CNT0002413) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019449752.1) |
Pfam | LSM domain (PF01423.21) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer