Protein coding transcript 172239

• Transcript: Ll_transcript_24379
• CDS coordinates: 168-467 (+)
• Peptide sequence: MASITEEESTVKEPLDLIRLSLDERIYVKLRSDRELRGKLHAYDQHLNMILGDVEEVVTTVEIDDETYEEIVRTTKRTVPFLFVRGDGVILVSPPLRTA*
• ORF Type: complete

Annotations of Ll_transcript_24379

• Blastp: Sm-like protein LSM3B from Arabidopsis with 92.55% of identity
• Blastx: Sm-like protein LSM3B from Arabidopsis with 92.55% of identity
• Eggnog: LSM3 homolog, U6 small nuclear RNA associated (S. cerevisiae)(ENOG4111PB8)
• Kegg: Link to kegg annotations (AT1G76860)
• CantataDB: Link to cantataDB annotations (CNT0002413)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449752.1)
• Pfam: LSM domain (PF01423.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;