Protein coding transcript 172326

• Transcript: Ll_transcript_25084
• CDS coordinates: 145-960 (+)
• Peptide sequence: MASFIESAWQYLITHFSDFQLACLGSFFLHEGVFFLSGLPFMFLERVGWLRKYKIQAKSNTRAAQEKCIARLLLYHFGVNLPMLLLSYPVFRFMGMRSNFPLPSWEVILTQIIIYFILEDFIFYWGHRILHTKWLYKHVHSVHHEYATPFGLTSEYAHPAEILFLGFATIFGPAITGPHLITLWLWMSLRVLETVEAHSGYHFPWSLSNFIPLYGGADFHDYHHRLLYTKSGNYSSTFTYMDRIFGTDIGYRKLKALKNTSVEDSSEQKKQ*
• ORF Type: complete

Annotations of Ll_transcript_25084

• Blastp: Methylsterol monooxygenase 2-2 from Arabidopsis with 83.08% of identity
• Blastx: Methylsterol monooxygenase 2-2 from Arabidopsis with 83.08% of identity
• Eggnog: fatty acid hydroxylase(COG3000)
• Kegg: Link to kegg annotations (AT1G07420)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019420397.1)
• Pfam: Fatty acid hydroxylase superfamily (PF04116.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;