Transcript | Ll_transcript_357100 |
---|---|
CDS coordinates | 530-1114 (+) |
Peptide sequence | MTIDRVKASLVQLGCPSRVPDDSYTIDLKNIIELARNDEVESIVLKRYGPYAYRMFRLLSKANCFLETDKIAESTLVEKKEAPRLLHGLWKDNYLHMEKLQVMASKQSRFVMWKVNKPQLWDYVLDEMYHAALNLNLRLGLEQEKDVELLSVPLDKINESKSLQKKFERRRRVRLLLGSSLMKLDDALMLFHDF* |
ORF Type | complete |
Blastp | DNA-directed RNA polymerase III subunit rpc3 from Dictyostelium with 26.62% of identity |
---|---|
Blastx | - |
Eggnog | DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Specific core component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs(ENOG410XPVH) |
Kegg | Link to kegg annotations (DDB_G0268080) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019442131.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer