Protein coding transcript 172381

• Transcript: Ll_transcript_24451
• CDS coordinates: 562-1197 (+)
• Peptide sequence: METGGFGFVSKFILCAISAALTGCFATAGALTGAIAGALAAKASKSSFVHGISFGAVAGAIISVEVLEASRAYWFMDQTGSRGTSSMADFIEGLVRRRLVEESLAPVILTAYNLQFEQARFANATYDAIHDVHSLAASSRGLSRDSLNNLPHYVVLKDMKAENTCCTICLQDIEVGETARSLPRCHHTFHLICVDKWLVNNDSCPFCRQGV*
• ORF Type: complete

Annotations of Ll_transcript_24451

• Blastp: NEP1-interacting protein-like 2 from Arabidopsis with 52.94% of identity
• Blastx: NEP1-interacting protein-like 2 from Arabidopsis with 52.97% of identity
• Eggnog: zinc ion binding(ENOG41121N2)
• Kegg: Link to kegg annotations (AT1G74410)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019463435.1)
• Pfam: Ring finger domain (PF13639.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;