Protein coding transcript 172382

• Transcript: Ll_transcript_24452
• CDS coordinates: 455-1111 (+)
• Peptide sequence: METGGIEGGGVLRFMSKLILCAISAALTGFFAIAGALGGALVGALAAKASKSSFLRGTSLGAIAGAIISVEVLEASRDFLSMDRTGSQGASYMAHFIDELVRGRLVEESLTPVIVPAYNLQVEQAHHANTGYDEIYDFRYDSLVVSRGLSRDSLNKLPHHVVLNADNTCCTICLQDIEVGETARSLPQCQHTFHLICVDKWLVKNDSCPVCRQAHFDI*
• ORF Type: complete

Annotations of Ll_transcript_24452

• Blastp: NEP1-interacting protein-like 2 from Arabidopsis with 50.24% of identity
• Blastx: NEP1-interacting protein-like 2 from Arabidopsis with 49.03% of identity
• Eggnog: zinc ion binding(ENOG41121N2)
• Kegg: Link to kegg annotations (AT1G74410)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019451495.1)
• Pfam: Glycine-zipper domain (PF13436.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;