Transcript | Ll_transcript_24441 |
---|---|
CDS coordinates | 455-1102 (+) |
Peptide sequence | METGGIEGGGVLRFMSKLILCAISAALTGFFAIAGALGGALVGALAAKASKSSFLRGTSLGAIAGAIISVEVLEASRDFLSMDRTGSQGASYMAHFIDELVRGRLVEESLTPVIVPAYNLQVEQAHHANTGYDEIYDFRYDSLVVSRGLSRDSLNKLPHHVVLNADNTCCTICLQDIEVGETARSLPQCQHTFHLICVDKWLVKNDSCPVCRQGA* |
ORF Type | complete |
Blastp | NEP1-interacting protein-like 2 from Arabidopsis with 50% of identity |
---|---|
Blastx | NEP1-interacting protein-like 2 from Arabidopsis with 48.68% of identity |
Eggnog | zinc ion binding(ENOG41121N2) |
Kegg | Link to kegg annotations (AT1G74410) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019451495.1) |
Pfam | Glycine-zipper domain (PF13436.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer