Protein coding transcript 172394

• Transcript: Ll_transcript_23812
• CDS coordinates: 156-1481 (+)
• Peptide sequence: MAIAPFATTQWGIRPHHIFTKSTIMGRVASSTSTHNVTSRVSFMAAPSSSFFSRDSLRGLYDMGSSQTLHRRRGSKLIVRAEADYYSVLGVSKNASKSEIKSAYRKLARNYHPDVNKEPGAEQKFKDISNAYEVLSDDEKRSIYDTYGEAGLKGSAGMGGMGDFNNPFDLFETLFEGMNGGMNSRGSPNGAVEGEDEYYSLVLNFKEAVFGVEKEIEIRRLESCGTCNGSGAKPGTKSSRCSTCGGQGRVVSQTRTPLGIFQQTMTCSSCNGRGETSTPCNACSGDGRVRRTKRISLKVPAGVDSGSRLRVRNEGNAGKRGGPSGDLFVVLEVIPDPVLKRDDTNILYTCKVSYIDAILGTIIKVPTVDGTVDLKIPSGTQPGATLVMARKGIPVLNKSNMRGDQLVRVQVEIPKRLSSDEKDLIEKLADLSKGKTATSRK*
• ORF Type: complete

Annotations of Ll_transcript_23812

• Blastp: Chaperone protein dnaJ A6, chloroplastic from Arabidopsis with 72.91% of identity
• Blastx: Chaperone protein dnaJ A6, chloroplastic from Arabidopsis with 72.69% of identity
• Eggnog: ATP binding to DnaK triggers the release of the substrate protein, thus completing the reaction cycle. Several rounds of ATP-dependent interactions between DnaJ, DnaK and GrpE are required for fully efficient folding. Also involved, together with DnaK and GrpE, in the DNA replication of plasmids through activation of initiation proteins (By similarity)(COG0484)
• Kegg: Link to kegg annotations (AT2G22360)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019414866.1)
• Pfam: DnaJ domain (PF00226.30)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;