Protein coding transcript 172400

• Transcript: Ll_transcript_23807
• CDS coordinates: 156-476 (+)
• Peptide sequence: MAIAPFATTQWGIRPHHIFTKSTIMGRVASSTSTHNVTSRVSFMAAPSSSFFSRDSLRGLYDMGSSQTLHRRRGSKLIVRAEADYYSVLGVSKNASKSEIKSGMFP*
• ORF Type: complete

Annotations of Ll_transcript_23807

• Blastp: Chaperone protein dnaJ A6, chloroplastic from Arabidopsis with 48.11% of identity
• Blastx: Chaperone protein dnaJ A8, chloroplastic from Oryza sativa with 93.94% of identity
• Eggnog: ATP binding to DnaK triggers the release of the substrate protein, thus completing the reaction cycle. Several rounds of ATP-dependent interactions between DnaJ, DnaK and GrpE are required for fully efficient folding. Also involved, together with DnaK and GrpE, in the DNA replication of plasmids through activation of initiation proteins (By similarity)(COG0484)
• Kegg: Link to kegg annotations (AT2G22360)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019414866.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;