Transcript | Ll_transcript_24240 |
---|---|
CDS coordinates | 192-581 (+) |
Peptide sequence | MERRRHEPIITTNGRSSLWRRTMATPGSAAGSGGGSSEGSSAKAMVAEQISQAVQSTSNLLHLMQHSSPAQVKLSMLPKNLLAKVPTIKNTEQILEQMPGVISSLDAHMDYGLQKLELSFCMTEYTVLL* |
ORF Type | complete |
Blastp | Tobamovirus multiplication protein 2B from Arabidopsis with 58.24% of identity |
---|---|
Blastx | Tobamovirus multiplication protein 2B from Arabidopsis with 64.79% of identity |
Eggnog | NA(ENOG410YYR9) |
Kegg | Link to kegg annotations (AT1G32370) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019443807.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer