| Transcript | Ll_transcript_24242 |
|---|---|
| CDS coordinates | 192-581 (+) |
| Peptide sequence | MERRRHEPIITTNGRSSLWRRTMATPGSAAGSGGGSSEGSSAKAMVAEQISQAVQSTSNLLHLMQHSSPAQVKLSMLPKNLLAKVPTIKNTEQILEQMPGVISSLDAHMDYGLQKLELSFCMTEYTVLL* |
| ORF Type | complete |
| Blastp | Tobamovirus multiplication protein 2B from Arabidopsis with 58.24% of identity |
|---|---|
| Blastx | Tobamovirus multiplication protein 2B from Arabidopsis with 64.79% of identity |
| Eggnog | NA(ENOG410YYR9) |
| Kegg | Link to kegg annotations (AT1G32370) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019443807.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer