Protein coding transcript 172412

• Transcript: Ll_transcript_24254
• CDS coordinates: 117-779 (+)
• Peptide sequence: MESLVQLQSLVIAKAPKSKAYFSASLSKPSFLFYCNATSVSAFSSVSIVGVRSKAKVKQNLGLGPIHASSEVADQTTNAAPTWILEPVGDGDTKHIGFKVDLPGVYEIASSDVTVGRVPEKADLVIPVATVSGVHARIQKKQESLLVTDLDSTNGTFVDDKRLRPGVVATVSSGSLITFGDTHLAIFRVSKVEKVEAADTVQENENGLNTDIKPDNTETN*
• ORF Type: complete

Annotations of Ll_transcript_24254

• Blastp: Zeaxanthin epoxidase, chloroplastic from Arabidopsis with 35.23% of identity
• Blastx: -
• Eggnog: oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen(COG0654)
• Kegg: Link to kegg annotations (AT5G67030)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458757.1)
• Pfam: Inner membrane component of T3SS, cytoplasmic domain (PF16697.4)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;