| Transcript | Ll_transcript_24411 |
|---|---|
| CDS coordinates | 580-1128 (+) |
| Peptide sequence | MNISMIGGLIAAGSYKHSVSVKFTYAFLCSFHRDRDYDRDYDRDYDRERGRGRDRDRDREKERDRDRYRIRDDKDYGRDREGRERERRERDRDRGRRRSYSRSRSRSRDRKEHDGGDYRKRRARGSISPRRHGDGAEDGEPKKKKEKKEKKEKKDDGTDHPDPEIAEANKLRASLGLKPLKL* |
| ORF Type | complete |
| Blastp | Pre-mRNA-splicing factor 38 from Arabidopsis with 80.77% of identity |
|---|---|
| Blastx | - |
| Eggnog | RNA splicing(ENOG410XQ3F) |
| Kegg | Link to kegg annotations (AT2G40650) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019452266.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer