Protein coding transcript 172435

• Transcript: Ll_transcript_24416
• CDS coordinates: 110-652 (+)
• Peptide sequence: MANRTDPAAKSIRGTNPQNLVEKILRSKIYQNTYWKEQCFGLTAETLVDKAMELDHLGGTYGGNRKPTPFMCLVMKMLQIQPEKEIVIEFIKNEDYKYVRILGAFYLRLTGSDIDVYRYLEPLYNDYRKLRQKLADGQFSLTHVDEVIDELLTKDYSCDIAMPRIKKRFCSVLIHILWFA*
• ORF Type: complete

Annotations of Ll_transcript_24416

• Blastp: Pre-mRNA-splicing factor 38 from Arabidopsis with 87.06% of identity
• Blastx: Pre-mRNA-splicing factor 38 from Arabidopsis with 87.06% of identity
• Eggnog: RNA splicing(ENOG410XQ3F)
• Kegg: Link to kegg annotations (AT2G40650)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003556528.1)
• Pfam: PRP38 family (PF03371.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;