Protein coding transcript 172436

• Transcript: Ll_transcript_24417
• CDS coordinates: 110-763 (+)
• Peptide sequence: MANRTDPAAKSIRGTNPQNLVEKILRSKIYQNTYWKEQCFGLTAETLVDKAMELDHLGGTYGGNRKPTPFMCLVMKMLQIQPEKEIVIEFIKNEDYKYVRILGAFYLRLTGSDIDVYRYLEPLYNDYRKLRQKLADGQFSLTHVDEVIDELLTKDYSCDIAMPRIKKRWTIESLGALEPRRSALEEDFEEEEEKEDSDQPADEHEDRTHEKVHHFPF*
• ORF Type: complete

Annotations of Ll_transcript_24417

• Blastp: Pre-mRNA-splicing factor 38 from Arabidopsis with 85.87% of identity
• Blastx: Pre-mRNA-splicing factor 38 from Arabidopsis with 85.87% of identity
• Eggnog: RNA splicing(ENOG410XQ3F)
• Kegg: Link to kegg annotations (AT2G40650)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019452266.1)
• Pfam: PRP38 family (PF03371.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;