Transcript | Ll_transcript_24069 |
---|---|
CDS coordinates | 157-591 (-) |
Peptide sequence | MEIHQHQKNIQKDMKKHIEGGEKLSLENQQHQSLNQSSPQPSESTSPTHEFSFTISLNSSSTTFPDDKSKAQTSSLALDLSPADDIFFHGHLLPLHFLSHHTSSPRSSTNSMDSFTLPIKELLQDENLSKDNSVSSINENFSYK* |
ORF Type | complete |
Blastp | BRI1 kinase inhibitor 1 from Arabidopsis with 53.33% of identity |
---|---|
Blastx | BRI1 kinase inhibitor 1 from Arabidopsis with 54.44% of identity |
Eggnog | BRI1 kinase inhibitor(ENOG410YVQJ) |
Kegg | Link to kegg annotations (AT5G42750) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019430718.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer