Protein coding transcript 172445

• Transcript: Ll_transcript_24069
• CDS coordinates: 157-591 (-)
• Peptide sequence: MEIHQHQKNIQKDMKKHIEGGEKLSLENQQHQSLNQSSPQPSESTSPTHEFSFTISLNSSSTTFPDDKSKAQTSSLALDLSPADDIFFHGHLLPLHFLSHHTSSPRSSTNSMDSFTLPIKELLQDENLSKDNSVSSINENFSYK*
• ORF Type: complete

Annotations of Ll_transcript_24069

• Blastp: BRI1 kinase inhibitor 1 from Arabidopsis with 53.33% of identity
• Blastx: BRI1 kinase inhibitor 1 from Arabidopsis with 54.44% of identity
• Eggnog: BRI1 kinase inhibitor(ENOG410YVQJ)
• Kegg: Link to kegg annotations (AT5G42750)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019430718.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;