Protein coding transcript 172460

• Transcript: Ll_transcript_24321
• CDS coordinates: 250-738 (+)
• Peptide sequence: MENLIQLVNKIQRACTALGDHGEESALPTLWDALPSIAVVGGQSSGKSSVLESIVGKDFLPRGSGIVTRRPLVLQLHKIDEGREYAEFMHLPRKKFPDFAAVRQEIADETDRETGRSRGISSVPIHLSIYSPHVVNLTLVDLPGLTKVAVEGQPDSIVQDIEN
• ORF Type: 3prime_partial

Annotations of Ll_transcript_24321

• Blastp: Dynamin-related protein 12A from Soja with 88.41% of identity
• Blastx: Dynamin-related protein 12A from Soja with 88.41% of identity
• Eggnog: Dynamin family(COG0699)
• Kegg: Link to kegg annotations (547855)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019459306.1)
• Pfam: Dynamin family (PF00350.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;