Protein coding transcript 172523

• Transcript: Ll_transcript_25600
• CDS coordinates: 45-380 (+)
• Peptide sequence: MEGDTSSGLGNGTEIDSKISQTFHNSFVQVQNILGQNRMLVNETNWNYESKVPDNLSTNVGLIRELNNTIRRVFDLVSVDSLIEEVPIVELLNEYVQSCDIVTFNTIQLIQ*
• ORF Type: complete

Annotations of Ll_transcript_25600

• Blastp: Protein ELF4-LIKE 3 from Arabidopsis with 66.23% of identity
• Blastx: Protein ELF4-LIKE 3 from Arabidopsis with 66.23% of identity
• Eggnog: early flowering(ENOG410Y56Z)
• Kegg: Link to kegg annotations (AT2G06255)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020227478.1)
• Pfam: Protein of unknown function (DUF1313) (PF07011.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;