Protein coding transcript 172526

• Transcript: Ll_transcript_25609
• CDS coordinates: 159-503 (+)
• Peptide sequence: MEGDTFSGHGNGIYIDSKVAQAFQKSFVQVQNILDQNRVLINEINQNHESKVPDNLSRNVGLIRELNNNIRRVVDLYADLSTSFTKSMEVSSEGDSTGAVKSDGKASHKRLRPV*
• ORF Type: complete

Annotations of Ll_transcript_25609

• Blastp: Protein ELF4-LIKE 4 from Arabidopsis with 69.64% of identity
• Blastx: Protein ELF4-LIKE 4 from Arabidopsis with 69.64% of identity
• Eggnog: early flowering(ENOG410Y56Z)
• Kegg: Link to kegg annotations (AT1G17455)
• CantataDB: Link to cantataDB annotations (CNT0000143)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019463982.1)
• Pfam: Protein of unknown function (DUF1313) (PF07011.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;