Protein coding transcript 172542

• Transcript: Ll_transcript_23871
• CDS coordinates: 127-549 (+)
• Peptide sequence: MVLQNDIDLLNPPVELEKRKHKLKRLVQTPNSFFMDVKCQGCFQHVSEVLLFCFFILVFFITTRGRASVRYLGCLLGCVWELRGKGRREINGHGGEEEKGKKKQIKLNFSLFESVKFRWEEKEGLSNDNAKILFYFPLKI*
• ORF Type: complete

Annotations of Ll_transcript_23871

• Blastp: 40S ribosomal protein S27-1 from Arabidopsis with 59.49% of identity
• Blastx: 40S ribosomal protein S27-1 from Arabidopsis with 95.35% of identity
• Eggnog: 40s ribosomal protein S27(COG2051)
• Kegg: Link to kegg annotations (AT2G45710)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019459285.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;